SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15614790|ref|NP_243093.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15614790|ref|NP_243093.1|
Domain Number 1 Region: 64-328
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.61e-51
Family L-arabinose binding protein-like 0.00018
Further Details:      
 
Domain Number 2 Region: 3-48
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000366
Family GalR/LacI-like bacterial regulator 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15614790|ref|NP_243093.1|
Sequence length 347
Comment AraC/XylS family transcriptional regulator [Bacillus halodurans C-125]
Sequence
MATIKDIAKLANVSNATVSRVLNRDATLSVTEETRERIYSIAKELGYKRIKERQETKKQV
APNIGIIILQSPEEEIDDPYFNSIRNGVEQTLQAKGIYSTKVIHVQDSTTTSNIDGLDGL
IIIGGVTSDKIKQMTAPLEHLVFVNRCPSEEEFDSVVIDFEKATSKALDYLFLKGFRRIG
YIGGTERQLSDQGKVEIEDFRHTVYVKKMEELGLYEPSLVFIGEYKMTEGYKLMKRAIEA
GNLPEAFFISSDPMAVGALRALKEANIAVPRDVSLVSFNDNEMAQFVDPPLTTVKVFTEQ
MGEMAVQLLLDRLNGRTLPLKVVVPTELVVRESVSEAVTAIKGGGVS
Download sequence
Identical sequences A0A0M0KJC6 Q9KAR0
WP_010898383.1.28103 WP_010898383.1.91347 gi|15614790|ref|NP_243093.1| 272558.BH2227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]