SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15615022|ref|NP_243325.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15615022|ref|NP_243325.1|
Domain Number - Region: 29-92
Classification Level Classification E-value
Superfamily FlgN-like 0.0183
Family FlgN-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15615022|ref|NP_243325.1|
Sequence length 102
Comment flagellar hook-basal body protein FliE [Bacillus halodurans C-125]
Sequence
MAEIQTVTAPVFLNQANSSSVNKHTPAEAQETFKQALSQAINNVNDLQKVSAEKTELLAK
GKIEDLHDVMITGQKASITLSATVEIRNKVIEAYQEIMRMQV
Download sequence
Identical sequences A0A0M0KJH0 Q9KA31
356767 APC37995 272558.BH2459 WP_010898612.1.28103 WP_010898612.1.91347 gi|15615022|ref|NP_243325.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]