SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15615452|ref|NP_243755.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15615452|ref|NP_243755.1|
Domain Number 1 Region: 2-198
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000000000000875
Family L-arabinose binding protein-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15615452|ref|NP_243755.1|
Sequence length 290
Comment comK transcriptional activator [Bacillus halodurans C-125]
Sequence
MVGLLVEDTIDDQGWNRKAYEGLLNIHSNLDVDVVLEEGVNSEQKAHRRIKELVDGGVNL
IFGHGHAFAEYFSTIHNQYPDVHFVSFNGEVKGENITSLHFEGYAMGYFGGMVAASMSET
HKVGVIAAFPWQPEVEGFVDGAKYMNESEAFVRYVGEWTDADKALELFQELQKEQVDVFY
PAGDGYHVPVVEAIKDQGDFAIGYVGDQADLGGSTILTSTVQHVDDLYVLVAKRFQEGKL
ESGNLYYDFQDGVVSLGEFSSVVPDEVREQITDAISTYIQTGQFPHEEER
Download sequence
Identical sequences Q9K8W3
272558.BH2889 BSGCAIR31267 gi|15615452|ref|NP_243755.1| WP_010899036.1.28103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]