SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15615472|ref|NP_243775.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15615472|ref|NP_243775.1|
Domain Number 1 Region: 53-184
Classification Level Classification E-value
Superfamily RmlC-like cupins 2.38e-24
Family Probable transcriptional regulator VC1968, C-terminal domain 0.0046
Further Details:      
 
Domain Number 2 Region: 5-75
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 4.83e-21
Family Probable transcriptional regulator VC1968, N-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15615472|ref|NP_243775.1|
Sequence length 189
Comment hypothetical protein BH2909 [Bacillus halodurans C-125]
Sequence
MNKEMLSKRIGQRLKRIRSDRGMTLDQLAKKTGVSKPMLGQIERGESNPTVSTLWKIATG
LHVSFTAFIEDEKPNVTVIKRDQVLPIIDGCDFQVFPLFPRSKDKPFEIFSVKLEAGTDH
TSEGHAQGVHEFVIVEKGTLNVKIGDEVYVLERGDGIHFPADQVHHYINGSSSEACVFTN
IISYEWTGL
Download sequence
Identical sequences A0A0M0KHP0 Q9K8U3
gi|15615472|ref|NP_243775.1| WP_010899056.1.28103 WP_010899056.1.91347 272558.BH2909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]