SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15615491|ref|NP_243794.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15615491|ref|NP_243794.1|
Domain Number - Region: 60-116
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 0.0379
Family Glutamyl tRNA-reductase dimerization domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15615491|ref|NP_243794.1|
Sequence length 199
Comment hypothetical protein BH2928 [Bacillus halodurans C-125]
Sequence
MNEGNHQGSEKKKKTNRSGKYKAYKWPAIIMITGLILSFFYKYGDMIFEDKTVPEAVTPE
IQESIRETQEAFAQEREASMVEETIQPVELFLQRLAEHELEAALSQIVEPSYQSIIRENL
DHPLFEQLIGAEIAEVFYPHRGLSLVAYCLLVNEETDVQAIVGVELGQIAYIYADDWNES
QEDIEKYESLLEEIKHNED
Download sequence
Identical sequences Q9K8S5
gi|15615491|ref|NP_243794.1| WP_010899074.1.28103 272558.BH2928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]