SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15616058|ref|NP_244363.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15616058|ref|NP_244363.1|
Domain Number 1 Region: 121-269
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 3.14e-43
Family Multidrug-binding domain of transcription activator BmrR 0.0029
Further Details:      
 
Domain Number 2 Region: 5-109
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 5.49e-30
Family DNA-binding N-terminal domain of transcription activators 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15616058|ref|NP_244363.1|
Sequence length 271
Comment multidrug-efflux transporter genes transcriptional regulator [Bacillus halodurans C-125]
Sequence
MKNQFPIGEMAKLHNTSIKTLRYYDEIGLLKPDYIDPNNGYRYYSTEQFEHLNTIHYLKE
LGFSLKEIKKHLEDRDIDGFLTLLEKQKELTEAKIKELERINRRFENRIHDIKWARHIEE
LGIVTIKDMEKRKIVRLKETIRSEPELEITLRQLENKSKMTSSIFIGGVGLTVSMRNIKS
NKFNEYNSIFILIEDDIQNPLVATLQEGKYACIYFRGNHHDSPKYYKALLNYIQTNNLHM
IGDAIERTIIDHYISESKDDYLTEIQIPIKY
Download sequence
Identical sequences Q9K774
272558.BH3496 gi|15616058|ref|NP_244363.1| WP_010899628.1.28103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]