SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15616125|ref|NP_244430.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15616125|ref|NP_244430.1|
Domain Number - Region: 331-374
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00466
Family SinR domain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15616125|ref|NP_244430.1|
Sequence length 445
Comment RNA polymerase sigma factor (sigma54) [Bacillus halodurans C-125]
Sequence
MEFGLFQQQTTSLVMTNELRQAISLLQYSTVDLAAFIEEQALENPLIELKDRSDRVLSEH
IRMMREERPEGEGTLDWSQSSPFDYLHVERLNLSDYLIQQARDLPLNKNEFEWLCYFIYS
LRDDGYLSRSLHSLQADLGLTDQEAEKTLYHLQHLEPAGIGARSLQECLLLQLQRKKQRD
PLAETIVEHYMELLAEKRWKMIADDLQISLADVQRVYDCIQQLDPRPGSQIGGEPTNYLV
PDVTIDWVEGELTILLQDDYLPKITLNRQYQTLLTDGEGEAAQYAKEKYHQMQWLVKSIQ
QRQQTLLKVTEAILRKQRAFFEEKEGALQPLTLREVAEEIGVHESTVSRATTNKYAQTPR
GLLELKSFFVSSISSRFGEKGPSSDSVKKLVRKLVEEENKAKPLSDQKIAHLLKDQYNVE
ASRRVIAKYRDELGIPSSTKRKRYG
Download sequence
Identical sequences A0A0M0KG45 Q9K710
272558.BH3563 WP_010899692.1.28103 WP_010899692.1.91347 gi|15616125|ref|NP_244430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]