SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15616184|ref|NP_244489.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15616184|ref|NP_244489.1|
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily FlgN-like 0.00000000000288
Family FlgN-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15616184|ref|NP_244489.1|
Sequence length 165
Comment flagellar protein [Bacillus halodurans C-125]
Sequence
MSAKQVIGSLTELLHIHQELLTCAKEKAAAIKNNDMVSLEKLVRAETALIHKGQVQEKIR
SKEVAAFFDRCGQAPDELTVGAMLPHVTKEEQAELERTQSALIETIMALQVENERNQLLI
QESLSFVNMSLDLLLPSAEHTSYQPPQQKERHGYEEGYSTFDSKA
Download sequence
Identical sequences Q9K6V3
gi|15616184|ref|NP_244489.1| 272558.BH3622 367097 APC7716 WP_010899750.1.28103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]