SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15616196|ref|NP_244501.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15616196|ref|NP_244501.1|
Domain Number 1 Region: 181-293
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.96e-29
Family Rob transcription factor, C-terminal domain 0.024
Further Details:      
 
Domain Number 2 Region: 57-106
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000319
Family AraC type transcriptional activator 0.0029
Further Details:      
 
Domain Number 3 Region: 5-55
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000466
Family AraC type transcriptional activator 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15616196|ref|NP_244501.1|
Sequence length 300
Comment AraC/XylS family transcriptional regulator [Bacillus halodurans C-125]
Sequence
MSYIQSVQRAIDYIETHLHEPISLEKVAAHASYSYFHFHRLFKATVGCTMSEYIKRRRLT
KAAYALLETKASIIDIAFEYGYESQEAFTRAFKQWFNVLPGKYRQARPPVQLIDPYWAVK
TFPVNATGDHKPYIVTRQPLQVVGLQLEGLSLPGGSDREQTTQVAIPSLWHQLEARIHEI
ERRVDPFVSYGISSPSRDGSHFTYMACVEIEAGDVNIPQGFIQKEIKGGTYASFHYKGAA
NQLSALTNYIYGSWLPSSQYQSHFGVEIEVYDEREPKEDGEVAVEIWTPIKKRAKQSSQK
Download sequence
Identical sequences Q9K6U1
272558.BH3634 gi|15616196|ref|NP_244501.1| WP_010899762.1.28103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]