SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15616294|ref|NP_244599.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15616294|ref|NP_244599.1|
Domain Number 1 Region: 43-310
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.8e-89
Family L-arabinose binding protein-like 0.0000000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15616294|ref|NP_244599.1|
Sequence length 311
Comment ribose ABC transporter ribose-binding protein [Bacillus halodurans C-125]
Sequence
MKKGLLWMMLVALAAFMVACSTESPVDEGNAEGGTSEGGDGDFTVGLSISTLNNPFFVTL
QEGAEAKAEELGVDLITVDAQDDDAKQISDVEDLIQRGVDLILINPTDSTSVTSAIAAAN
AAGIPVITVDRGAEGGEVVSHIASDNVAGGEMAGELLKELVGEGAEVAELEGIPGSSAAR
ERGEGFHNVAEGSLEVAAKQTANFNRAEGLTVMENILQSNPEITGVFAHNDEMALGALEA
IDAAGRDDIVIVGFDATDDAVAAVEAGRLAGTVAQQPTLIGETAVATAFSVLSGDDVEEF
IPVDLELVTNE
Download sequence
Identical sequences A0A0M0KGT7 Q9K6J7
gi|15616294|ref|NP_244599.1| WP_010899857.1.28103 WP_010899857.1.91347 272558.BH3732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]