SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15616402|ref|NP_244707.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15616402|ref|NP_244707.1|
Domain Number 1 Region: 55-313
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.21e-61
Family L-arabinose binding protein-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15616402|ref|NP_244707.1|
Sequence length 332
Comment sugar ABC transporter sugar-binding protein [Bacillus halodurans C-125]
Sequence
MKRHLFFVVGFMICISALATSIYSFVQVTRVETNVPSSTSISLPSSHFVLIAEEENNSYW
RLVEKGAREAENQFDVLVEYKAPKRSNPEEQLKLIDMAISAKVDGIIVQAVNEEMFTPLI
NKAVDAGIPVITIDTDAPRSNRVAYIGTDNYYSGTIAGKAMLDDMEGDIHVAVITGSLES
SHQKLRVQGFIDMISNEPRVTLVEVEASNISRLEAELKAHQLMEEHPHINAFYGTSALDG
IGIVAAAEKLGLDDLYVIAFDTLPENLSLLEQEKIDAIVVQEPFEMGLKSVELLLDIREG
QPYSMTNHTHTSIIRKPDLSLLQEHQRLGDKQ
Download sequence
Identical sequences A0A0M0KG48 Q9K692
WP_010899965.1.28103 WP_010899965.1.91347 272558.BH3840 gi|15616402|ref|NP_244707.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]