SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15616570|ref|NP_244876.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|15616570|ref|NP_244876.1|
Domain Number - Region: 17-49
Classification Level Classification E-value
Superfamily HSP33 redox switch-like 0.0224
Family HSP33 redox switch-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15616570|ref|NP_244876.1|
Sequence length 52
Comment hypothetical protein BH4008 [Bacillus halodurans C-125]
Sequence
MYNTCLEHVELAMEIIIDEKETAPIINQLTEDEQLSTTCAFCKNNAIYSISE
Download sequence
Identical sequences Q9K5T0
272558.BH4008 WP_010900132.1.28103 gi|15616570|ref|NP_244876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]