SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15616609|ref|NP_244915.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15616609|ref|NP_244915.1|
Domain Number 1 Region: 21-167
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 5.23e-35
Family Multidrug-binding domain of transcription activator BmrR 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15616609|ref|NP_244915.1|
Sequence length 169
Comment hypothetical protein BH4047 [Bacillus halodurans C-125]
Sequence
MKQLVLEKSRITQEAMAIDPSAIVFEEKEEERLFVTVAKPLTDKKNIYDSIYHHYCCLQD
YQIGATHSAGWMIDTNKVYAEDYLSYDYLYTKVNPSDYANFTIKKGTYLVAYHSAGYSSI
EQSYDRLITFAKEHNLTLKGFFYEDILLDELSVKGFEKYLIKLFVRMDT
Download sequence
Identical sequences Q9K5P1
gi|15616609|ref|NP_244915.1| 272558.BH4047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]