SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15615535|ref|NP_243839.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15615535|ref|NP_243839.1|
Domain Number 1 Region: 44-306
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.5e-43
Family Transferrin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15615535|ref|NP_243839.1|
Sequence length 313
Comment alkylphosphonate ABC transporter phosphate-binding protein [Bacillus halodurans C-125]
Sequence
MKKMLYFLGVSMLVFVLAACGTSDDGDTAGSGEADGADEAGEMPSELIMGFVPSSESDQI
ADTVEPLAERLSEELGIPVSGQVMTNYTGLVEAMGNDQVHIGFIPAFGYVLATDRYPQVE
VILKSVRNGSGTYRAQYTVLADSDIESIEDLEGKVWVYSDLASTSGYLFPAAQLVTEYDV
PADGIDSFFGNQIQAGSHDNALITVLEGGADVATTFEDAREIIEGDYPEAMEDLRVIGYT
EEIPNDTISVLNTLPQELIDQIRDVFLSFNEDEDMIKILNDVYRWDAIEEASDDEYDIVR
ETYELFSDQVSLD
Download sequence
Identical sequences A0A0M0KIL7 Q9K8N2
gi|15615535|ref|NP_243839.1| WP_010899118.1.28103 WP_010899118.1.91347 272558.BH2973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]