SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15615556|ref|NP_243860.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15615556|ref|NP_243860.1|
Domain Number 1 Region: 56-332
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.94e-61
Family Phosphate binding protein-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15615556|ref|NP_243860.1|
Sequence length 335
Comment phosphate ABC transporter phosphate-binding protein [Bacillus halodurans C-125]
Sequence
MNVKKFMLLLTMTVLMVIVAACGSGEDTQAEPGDEETTEAPEETTEEATGSDELEGSVVV
DGSGTVYPLMAAIAEEYMISEQPNVSVEVSRAGTSAGFGKFLVENGTDFNDASRQIKDEE
KETAEELGIDVQEFKVALDGLTFVIHPDNDWATELTKEELISIFAADGGVEKWSDIRPEF
PDEEINPMGPNENHGTYEFFYEVIMEEQDLVDNVNLQQEYSTLVNLVSEDPNAIAFFGFG
YYVNNQDQLGAVHVDFGDGPVEPNLETIAEDGDYAPFTRPVFTYLNVNHAKEKPEVLDFA
LFVVNNVNEFAGETGFAPLPEEEVQEYVNFLEGLK
Download sequence
Identical sequences Q9K8L2
WP_010899138.1.28103 WP_010899138.1.91347 APC41272.0 gi|15615556|ref|NP_243860.1| 272558.BH2994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]