SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15616041|ref|NP_244346.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15616041|ref|NP_244346.1|
Domain Number 1 Region: 6-245
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.12e-65
Family Phosphate binding protein-like 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|15616041|ref|NP_244346.1|
Sequence length 246
Comment hypothetical protein BH3479 [Bacillus halodurans C-125]
Sequence
MDEPVTIKIGASAVPHTEVLEFAAPLLEERGITLEIETFTDYILPNTALRDGDIDVNYFQ
TPGYLAQQIEEYDYDFVSLGEVHAEPIGIYSKEYSSLEELPEGAEIIFSDSISDHGRILP
IFERAGLIELDVEEGELATIDDISSNPKNLVFGSQQVEARFLAPSFENGEGDAVAINTNY
ALEGGVDIEQYGIAFESEDVLQPNLIVVRAEDQDRPEFQVLVEVLQSEEVRQFIEEQYNG
AVIPMG
Download sequence
Identical sequences Q9K791
272558.BH3479 gi|15616041|ref|NP_244346.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]