SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15616145|ref|NP_244450.1| from Bacillus halodurans C-125

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15616145|ref|NP_244450.1|
Domain Number 1 Region: 2-207
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.99e-66
Family Phosphate binding protein-like 0.00000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15616145|ref|NP_244450.1|
Sequence length 212
Comment ATP phosphoribosyltransferase catalytic subunit [Bacillus halodurans C-125]
Sequence
MSMLTVAMPKGRIFDEAVGLLRKAGYNLPAEFEASRKLIVDVPEENMRFILAKPMDVPTY
VEHGVADVGVAGKDVMLEEERDVYEVLDLKISECYLAVAGLPNYEKKHDLNPKVASKYPH
LATRYFKEQGEQVEIIKLNGSIELAPLIGLADRIVDIVSTGRTLRENGLVELEKMMTITS
RLIVNPVSYRMKDERIDEMVERLLQVVEGDGA
Download sequence
Identical sequences A0A0M0KG24 Q9K6Z1
gi|15616145|ref|NP_244450.1| 272558.BH3583 WP_010899711.1.28103 WP_010899711.1.91347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]