SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|377822385|ref|YP_005175311.1| from Mycoplasma pneumoniae 309

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377822385|ref|YP_005175311.1|
Domain Number 1 Region: 179-277
Classification Level Classification E-value
Superfamily PTS system IIB component-like 3.84e-29
Family PTS system, Fructose specific IIB subunit-like 0.00035
Further Details:      
 
Domain Number 2 Region: 4-147
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 4.45e-29
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|377822385|ref|YP_005175311.1|
Sequence length 694
Comment fructose-permease IIBC component [Mycoplasma pneumoniae 309]
Sequence
MFKPLLSAELFFNWTAKDFKDKTSFLKQACRVLQAKNCIKEEQIALTALKEREAQITTGI
MSKLALPHMQSATVLKPFVAVFKVNNVDWQSLDNQPVKLIFLIGVPKDQGNLHLEFISQF
SKLMLQDEFANKVPNIRSFNGLINLIDSFQQTAVASQPVVNEAAAQTEEPKDTNTQYDFV
AVTACPTGIAHTFMAKEALEKFARDHNLKVKVETQGTDGIQNQLTESDLNNTKGIILACD
RLIDLTRFYGHANVVEVSTTKAIKTPQTVYDQVVKKEGKLLGNKSSDSASQTELKETTEQ
LSFKDFHKRIYRAILSGVSYMLPFVVFGGILIAIAFLIDINNAGNAGKQFGSKDPIANWF
KTLGGLSFGLIVPILSAYIAFALVGRQGLLPGFIVGLISAGKFLLNIDIVTGKIDWATES
KVSSGFFGAIFGGLLAAVLIIVQQRYIYRKLPQALQGIKNILFIPLLGTLVTAALFWVIN
IPLIYLNYGLSKFLQIMDKPYLAPLLGLVIGLMMCFDLGGPVNKAAYVFGVVSLESQNSG
TVAMASAILSGMVPPLGIAIAATIRKQCFDKEELPAAYACYVMGLSFISEGAIPFVAKRP
KIMLAANLIGGAVCGVLTGAFALTIRAPHGGVFVFALLKTNLEGIAGNTLQIGAGVGLAL
LALIVSSFISAGIIIGHNLLVVRKKTKQLVNTNA
Download sequence
Identical sequences WP_014325324.1.11751 WP_014325324.1.12221 WP_014325324.1.14858 WP_014325324.1.16039 WP_014325324.1.16859 WP_014325324.1.22813 WP_014325324.1.2663 WP_014325324.1.27161 WP_014325324.1.28556 WP_014325324.1.28653 WP_014325324.1.28828 WP_014325324.1.35481 WP_014325324.1.3603 WP_014325324.1.43551 WP_014325324.1.44097 WP_014325324.1.54913 WP_014325324.1.66736 WP_014325324.1.6837 WP_014325324.1.71692 WP_014325324.1.73307 WP_014325324.1.781 WP_014325324.1.84725 WP_014325324.1.86924 WP_014325324.1.89898 WP_014325324.1.92395 WP_014325324.1.92743 WP_014325324.1.9360 WP_014325324.1.93817 WP_014325324.1.94657 WP_014325324.1.95674 WP_014325324.1.97508 gi|377822385|ref|YP_005175311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]