SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|377822494|ref|YP_005175420.1| from Mycoplasma pneumoniae 309

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377822494|ref|YP_005175420.1|
Domain Number 1 Region: 134-214
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.1e-25
Family Translational machinery components 0.00032
Further Details:      
 
Domain Number 2 Region: 63-131
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.93e-20
Family Ribosomal S5 protein, N-terminal domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|377822494|ref|YP_005175420.1|
Sequence length 219
Comment 30S ribosomal protein S5 [Mycoplasma pneumoniae 309]
Sequence
MTDQNQKANQGNGLQTTNLQAHAQRKHNLRPSSEGIKKAVSKKEGGGHNRNNQNRRFQKP
AFKSEFEERIVKLKRISKTTKGGRNMRFSVLVVVGNRKGKIGYGIAKALEVPNAIKKAIK
AAHNSLHTIEIHKGSIYHEVIGRSGASRVLLKPAPQGTGIIAGGAIRAIIELAGYSDIYT
KNLGRNTPINMIHATMDGILKQLSPRRVAILRNKNLNEL
Download sequence
Identical sequences A0A0H3DP25 Q50301
272634.MPN182 gi|479052964|ref|YP_007347796.1| gi|385326780|ref|YP_005881212.1| gi|13507921|ref|NP_109870.1| NP_109870.1.17040 WP_010874539.1.101063 WP_010874539.1.11751 WP_010874539.1.12221 WP_010874539.1.12774 WP_010874539.1.13034 WP_010874539.1.14858 WP_010874539.1.1571 WP_010874539.1.16039 WP_010874539.1.16859 WP_010874539.1.19095 WP_010874539.1.2006 WP_010874539.1.22385 WP_010874539.1.22813 WP_010874539.1.23001 WP_010874539.1.24173 WP_010874539.1.24809 WP_010874539.1.24962 WP_010874539.1.2663 WP_010874539.1.27161 WP_010874539.1.28556 WP_010874539.1.28653 WP_010874539.1.28828 WP_010874539.1.29645 WP_010874539.1.31771 WP_010874539.1.32896 WP_010874539.1.34815 WP_010874539.1.35096 WP_010874539.1.35256 WP_010874539.1.35481 WP_010874539.1.35930 WP_010874539.1.3603 WP_010874539.1.4101 WP_010874539.1.43551 WP_010874539.1.44097 WP_010874539.1.45375 WP_010874539.1.46046 WP_010874539.1.50950 WP_010874539.1.54913 WP_010874539.1.56467 WP_010874539.1.56644 WP_010874539.1.60490 WP_010874539.1.61971 WP_010874539.1.63119 WP_010874539.1.63454 WP_010874539.1.63952 WP_010874539.1.66642 WP_010874539.1.66736 WP_010874539.1.68209 WP_010874539.1.6837 WP_010874539.1.69700 WP_010874539.1.71692 WP_010874539.1.73054 WP_010874539.1.73147 WP_010874539.1.73307 WP_010874539.1.77677 WP_010874539.1.781 WP_010874539.1.80830 WP_010874539.1.82550 WP_010874539.1.82952 WP_010874539.1.84725 WP_010874539.1.86690 WP_010874539.1.86924 WP_010874539.1.8980 WP_010874539.1.89898 WP_010874539.1.91711 WP_010874539.1.92395 WP_010874539.1.92743 WP_010874539.1.9360 WP_010874539.1.93817 WP_010874539.1.94569 WP_010874539.1.94657 WP_010874539.1.95064 WP_010874539.1.95674 WP_010874539.1.97031 WP_010874539.1.97508 WP_010874539.1.97662 WP_010874539.1.98952 WP_010874539.1.99226 gi|377822494|ref|YP_005175420.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]