SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|377822519|ref|YP_005175445.1| from Mycoplasma pneumoniae 309

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377822519|ref|YP_005175445.1|
Domain Number 1 Region: 769-935
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 6.1e-28
Family Glucose permease-like 0.00023
Further Details:      
 
Domain Number 2 Region: 666-737
Classification Level Classification E-value
Superfamily Glucose permease domain IIB 0.00000000000000667
Family Glucose permease domain IIB 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|377822519|ref|YP_005175445.1|
Sequence length 940
Comment PTS system glucose-specific transporter subunit IIABC [Mycoplasma pneumoniae 309]
Sequence
MQIKAQDTGQQKKSCLLSNIRNKWKNRNRGSFRQWVGKLSNGLMIPIAVLPIAGIFLGVG
DAIAGNAGDLTGLRYFGLFIKNGGDVVFANLPILFAIAIAITFSQDAGVAGFSAFVFWAA
MNGFMSSLILPFDKAGKIITDTSTPIAGFKVLYYKSVPVHAIATTLGLRTLSTSVFGGII
VGALTSVLYKKFYAIRLPDVIGFFSGTRFVPIICFVVAIPVALILLMIWPAVSIGLNAIG
TGLGFLGGKGYGANSLIFGYIERSLIPFGVHHAFYAPLWYTSAGGSLQEIVNQQVWIRPD
FHLSDNYVARVIGWVDPNNSSMYIIPGALNGQNGSSTGNTMSKDLNGALSAYMSKESTAF
LTWKDLVDGLTFKGNFDKMAENGLLDGSNKIWLGLNGSGILGKKLLLSDGNVYTITFKTF
ANTTPIAWSKGAQAVLPLNASSTIVNNPTALAAATQSNNNTNNIKLYPVNSFRVAVESLN
PAQYSQGKFPFMLFGIPAAGVAMILAAPKDRRKEAASIVGSAAFTSFLTGITEPFEFTFL
FLAPWLFYGVHAVLAAVSFWLMNILGANVGQTFSGSFIDFILYGALPDGRRWLANSYLVP
IIGLFLAAIYFPTFYFLIKHFNLATPGRGGKLITKKEYLASKAAAKAEGVSGVAENFTQT
QIEAGILLQAYGGKENIVELGACITKLRVTVKNPELVKEEPIKELGAAGVMRTTPTFFVA
VFGTRAAVYKSAMQDIIQGKVNWEALQKVINTDQLAVEPKETTPPKEVMPVVQDEIVILS
PVNGTLKSLNQVPDETFKQKLVGEGVAIVPSDGHFKAPGEAGVKTELAFPGGHAYIFDID
GIKVMLHIGIDTVQINAKKQPGEPLEVFDIKTKQGEYTKEKSESVVEVDLKKLSKKYNPI
TPFVVMKESLENFKLVPIRQRGEIKVGQPIFKLVYKKSQA
Download sequence
Identical sequences A0A0H3DMU9
WP_014325402.1.11751 WP_014325402.1.12221 WP_014325402.1.14858 WP_014325402.1.16039 WP_014325402.1.16859 WP_014325402.1.2006 WP_014325402.1.22385 WP_014325402.1.22813 WP_014325402.1.24173 WP_014325402.1.24962 WP_014325402.1.2663 WP_014325402.1.27161 WP_014325402.1.28556 WP_014325402.1.28653 WP_014325402.1.28828 WP_014325402.1.29645 WP_014325402.1.32896 WP_014325402.1.35256 WP_014325402.1.35481 WP_014325402.1.35930 WP_014325402.1.3603 WP_014325402.1.4101 WP_014325402.1.43551 WP_014325402.1.44097 WP_014325402.1.50950 WP_014325402.1.54913 WP_014325402.1.61971 WP_014325402.1.66736 WP_014325402.1.6837 WP_014325402.1.71692 WP_014325402.1.73307 WP_014325402.1.77677 WP_014325402.1.781 WP_014325402.1.84725 WP_014325402.1.86924 WP_014325402.1.89898 WP_014325402.1.92395 WP_014325402.1.92743 WP_014325402.1.9360 WP_014325402.1.93817 WP_014325402.1.94569 WP_014325402.1.94657 WP_014325402.1.95674 WP_014325402.1.97508 gi|479052987|ref|YP_007347819.1| gi|377822519|ref|YP_005175445.1| gi|385326802|ref|YP_005881234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]