SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|377822637|ref|YP_005175563.1| from Mycoplasma pneumoniae 309

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377822637|ref|YP_005175563.1|
Domain Number 1 Region: 173-700
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 3.36e-174
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000000001
Further Details:      
 
Domain Number 2 Region: 19-172
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.83e-46
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|377822637|ref|YP_005175563.1|
Sequence length 721
Comment ribonucleotide-diphosphate reductase, alpha subunit [Mycoplasma pneumoniae 309]
Sequence
MSVKEKIPAFNTQEDLESYISLNAYTKVYGDFKMDLHAVEAYIQEHVKPKTKVFHSTKER
LDFLVKNDYYDENIINMYSFEQFEEITRKAYAYRFRYANFMGAFKFYNAYALKTFDGKWY
LENYEDRVVMNVLFLANGNYNKALKLLKQIITNRFQPATPTFLNAGRKKRGEFVSCYLLR
IEDNMESIGRAITTTLQLSKRDGGVALLLTNIRESGAPIKKIENQSSGIIPIMKLLEDSF
SYANQLGQRQGAGAVYLHAHHPDVMQFLDTKRENADEKIRIKSLSLGLVIPDITFTLAKN
NEEMALFSPYDVYEEYGKPLSDISVTEMYYELLANQRIKKTFINARKFFQTVAELHFESG
YPYILFDDTVNRRNAHPNRIVMSNLCSEIVQPSTPSEFHHDLAFKKVGNDISCNLGSLNI
AKAMESGPEFSELVKLAIESLDLVSRVSNLETAPSIQKGNSENHALGLGAMNLHGFLATN
QIYYNSPEAIDFTNIFFYTVAYHAFKASSELALEKGKFKNFENTKFADGSYFDKYIKVEP
DFWTPKTERVKALFQKYQVEIPTRENWKELALNIQKNGLANSHLLAIAPTGSISYLSSCT
PSLQPVVSPVEVRKEGRLGRIYVPAYQLNKDSYPFYKDGAYELGPEPIINIAAAAQQHVD
QAISLTLFMTDKATTRDLNKAYIYAFKKGCSSIYYVRVRQEVLEDSEDHTIQMQQCEACV
I
Download sequence
Identical sequences P78027
272634.MPN324 gi|13508063|ref|NP_110012.1| NP_110012.1.17040 WP_010874680.1.11751 WP_010874680.1.14858 WP_010874680.1.16039 WP_010874680.1.16859 WP_010874680.1.2006 WP_010874680.1.22385 WP_010874680.1.22813 WP_010874680.1.24173 WP_010874680.1.24962 WP_010874680.1.2663 WP_010874680.1.28556 WP_010874680.1.29645 WP_010874680.1.31771 WP_010874680.1.32896 WP_010874680.1.35256 WP_010874680.1.35481 WP_010874680.1.35930 WP_010874680.1.3603 WP_010874680.1.4101 WP_010874680.1.43551 WP_010874680.1.50950 WP_010874680.1.54913 WP_010874680.1.61971 WP_010874680.1.66736 WP_010874680.1.6837 WP_010874680.1.71692 WP_010874680.1.73307 WP_010874680.1.77677 WP_010874680.1.781 WP_010874680.1.84725 WP_010874680.1.86924 WP_010874680.1.92743 WP_010874680.1.9360 WP_010874680.1.93817 WP_010874680.1.94569 WP_010874680.1.95674 gi|377822637|ref|YP_005175563.1| gi|479053098|ref|YP_007347930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]