SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|377822638|ref|YP_005175564.1| from Mycoplasma pneumoniae 309

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377822638|ref|YP_005175564.1|
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily L21p-like 2.62e-27
Family Ribosomal protein L21p 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|377822638|ref|YP_005175564.1|
Sequence length 100
Comment 50S ribosomal protein L21 [Mycoplasma pneumoniae 309]
Sequence
MHAIVVCGSKQYLVHENDTFFVEKLEAPVGKEIQLDKVLMLDEKIGAPYLEKARVVCVVE
KHGLQRKVNVIKHISQKHHLKKYGHRQPYTKLKVVRFVHD
Download sequence
Identical sequences A0A0H3DML2 P78026
272634.MPN325 gi|13508064|ref|NP_110013.1| gi|479053099|ref|YP_007347931.1| gi|377822638|ref|YP_005175564.1| gi|385326911|ref|YP_005881343.1| NP_110013.1.17040 WP_010874681.1.101063 WP_010874681.1.11751 WP_010874681.1.12221 WP_010874681.1.12774 WP_010874681.1.13034 WP_010874681.1.14858 WP_010874681.1.1571 WP_010874681.1.16039 WP_010874681.1.16859 WP_010874681.1.19095 WP_010874681.1.2006 WP_010874681.1.22385 WP_010874681.1.22813 WP_010874681.1.23001 WP_010874681.1.24173 WP_010874681.1.24809 WP_010874681.1.24962 WP_010874681.1.2663 WP_010874681.1.27161 WP_010874681.1.28556 WP_010874681.1.28653 WP_010874681.1.28828 WP_010874681.1.29645 WP_010874681.1.31771 WP_010874681.1.32896 WP_010874681.1.34815 WP_010874681.1.35096 WP_010874681.1.35256 WP_010874681.1.35481 WP_010874681.1.35930 WP_010874681.1.3603 WP_010874681.1.4101 WP_010874681.1.43551 WP_010874681.1.44097 WP_010874681.1.45375 WP_010874681.1.46046 WP_010874681.1.50950 WP_010874681.1.54913 WP_010874681.1.56467 WP_010874681.1.56644 WP_010874681.1.60490 WP_010874681.1.61971 WP_010874681.1.63119 WP_010874681.1.63454 WP_010874681.1.63952 WP_010874681.1.66642 WP_010874681.1.66736 WP_010874681.1.68209 WP_010874681.1.6837 WP_010874681.1.69700 WP_010874681.1.71692 WP_010874681.1.73054 WP_010874681.1.73147 WP_010874681.1.73307 WP_010874681.1.77677 WP_010874681.1.781 WP_010874681.1.80830 WP_010874681.1.82550 WP_010874681.1.82952 WP_010874681.1.84725 WP_010874681.1.86690 WP_010874681.1.86924 WP_010874681.1.8980 WP_010874681.1.89898 WP_010874681.1.91711 WP_010874681.1.92395 WP_010874681.1.92743 WP_010874681.1.9360 WP_010874681.1.93817 WP_010874681.1.94569 WP_010874681.1.94657 WP_010874681.1.95064 WP_010874681.1.95674 WP_010874681.1.97031 WP_010874681.1.97508 WP_010874681.1.97662 WP_010874681.1.98952 WP_010874681.1.99226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]