SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|377822809|ref|YP_005175735.1| from Mycoplasma pneumoniae 309

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377822809|ref|YP_005175735.1|
Domain Number 1 Region: 12-150
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 5.62e-30
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|377822809|ref|YP_005175735.1|
Sequence length 159
Comment PTS system ascorbate-specific transporter subunit IIA [Mycoplasma pneumoniae 309]
Sequence
MTKLDFKAVLKQHHTVRLHQTAQDWKQAIQLCIHPLIAAKLVQPAYFDDILKSVAQYGPY
FIIAENVAMPHAQNNGTVQQNCFSLVTLKEPVYFDNDPRPVRLLIGLAATSAAIHTTEAL
PQIAALVEDTQVVKDLLDCCDETSLFAVIDRVNLHKYLT
Download sequence
Identical sequences A0A0H3DNE2 P75292
gi|377822809|ref|YP_005175735.1| gi|479053242|ref|YP_007348074.1| gi|13508233|ref|NP_110182.1| NP_110182.1.17040 WP_010874850.1.101063 WP_010874850.1.11751 WP_010874850.1.12221 WP_010874850.1.12774 WP_010874850.1.13034 WP_010874850.1.14858 WP_010874850.1.1571 WP_010874850.1.16039 WP_010874850.1.16859 WP_010874850.1.19095 WP_010874850.1.2006 WP_010874850.1.22385 WP_010874850.1.22813 WP_010874850.1.23001 WP_010874850.1.24173 WP_010874850.1.24809 WP_010874850.1.24962 WP_010874850.1.2663 WP_010874850.1.27161 WP_010874850.1.28556 WP_010874850.1.28653 WP_010874850.1.28828 WP_010874850.1.29645 WP_010874850.1.31771 WP_010874850.1.32896 WP_010874850.1.34815 WP_010874850.1.35096 WP_010874850.1.35256 WP_010874850.1.35481 WP_010874850.1.35930 WP_010874850.1.3603 WP_010874850.1.4101 WP_010874850.1.43551 WP_010874850.1.44097 WP_010874850.1.45375 WP_010874850.1.46046 WP_010874850.1.50950 WP_010874850.1.54913 WP_010874850.1.56467 WP_010874850.1.56644 WP_010874850.1.60490 WP_010874850.1.61971 WP_010874850.1.63119 WP_010874850.1.63454 WP_010874850.1.63952 WP_010874850.1.66642 WP_010874850.1.66736 WP_010874850.1.68209 WP_010874850.1.6837 WP_010874850.1.69700 WP_010874850.1.71692 WP_010874850.1.73054 WP_010874850.1.73147 WP_010874850.1.73307 WP_010874850.1.77677 WP_010874850.1.781 WP_010874850.1.80830 WP_010874850.1.82550 WP_010874850.1.82952 WP_010874850.1.84725 WP_010874850.1.86690 WP_010874850.1.86924 WP_010874850.1.8980 WP_010874850.1.89898 WP_010874850.1.91711 WP_010874850.1.92395 WP_010874850.1.92743 WP_010874850.1.9360 WP_010874850.1.93817 WP_010874850.1.94569 WP_010874850.1.94657 WP_010874850.1.95064 WP_010874850.1.95674 WP_010874850.1.97031 WP_010874850.1.97508 WP_010874850.1.97662 WP_010874850.1.98952 WP_010874850.1.99226 gi|385327059|ref|YP_005881491.1| 272634.MPN494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]