SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|377822976|ref|YP_005175902.1| from Mycoplasma pneumoniae 309

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377822976|ref|YP_005175902.1|
Domain Number 1 Region: 289-377
Classification Level Classification E-value
Superfamily PTS system IIB component-like 1.1e-16
Family PTS system, Lactose/Cellobiose specific IIB subunit 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|377822976|ref|YP_005175902.1|
Sequence length 379
Comment PTS system mannitol-specific transporter subunit IIC [Mycoplasma pneumoniae 309]
Sequence
MFLCVMIFVPIAALILKHTEKFWIHRIKSGFEMLVNNFYLGFLGFALIFPSFYLSIYLIG
YIQLGLKLLVEIMQQYKLYPIAAIVIEPAKVLFLNNAINHGVLTPLGLQQVRDSGKSILF
LLESNPGPGLGLLVAFLIFFFKRDKKLSSNAASSGPIHLFGGIHEVYFPFVLLKPVLILA
TIAGGVVGNGILQIFNAGTIAPVSPGSVIAGFLQINKTPLDVAGYALALVLSAVTSLLIS
LLLLSLTRKKQLKTLQEAQAQVAEMKQTPAKKPRQKDTPAIATKIDFSQVTFVCDAGMGS
STMGAAIFRKELKNQNIEDITVINKAIVDLKDEKVIITISQLYDRVKAKRADATIYTINQ
FLDKQGYLTIIEKIKNEKN
Download sequence
Identical sequences WP_014325661.1.11751 WP_014325661.1.14858 WP_014325661.1.16039 WP_014325661.1.16859 WP_014325661.1.22813 WP_014325661.1.2663 WP_014325661.1.27161 WP_014325661.1.28556 WP_014325661.1.28653 WP_014325661.1.28828 WP_014325661.1.35481 WP_014325661.1.3603 WP_014325661.1.43551 WP_014325661.1.44097 WP_014325661.1.54913 WP_014325661.1.66736 WP_014325661.1.6837 WP_014325661.1.71692 WP_014325661.1.73307 WP_014325661.1.781 WP_014325661.1.84725 WP_014325661.1.86924 WP_014325661.1.89898 WP_014325661.1.92395 WP_014325661.1.92743 WP_014325661.1.9360 WP_014325661.1.93817 WP_014325661.1.94657 WP_014325661.1.95674 WP_014325661.1.97508 gi|377822976|ref|YP_005175902.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]