SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|377822990|ref|YP_005175916.1| from Mycoplasma pneumoniae 309

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377822990|ref|YP_005175916.1|
Domain Number 1 Region: 9-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.25e-59
Family G proteins 0.000000246
Further Details:      
 
Domain Number 2 Region: 298-393
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 5.18e-34
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000122
Further Details:      
 
Domain Number 3 Region: 205-301
Classification Level Classification E-value
Superfamily Translation proteins 3.14e-29
Family Elongation factors 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|377822990|ref|YP_005175916.1|
Sequence length 394
Comment ranslation elongation factor EF-Tu [Mycoplasma pneumoniae 309]
Sequence
MAREKFDRSKPHVNVGTIGHIDHGKTTLTAAICTVLAKEGKSAATRYDQIDKAPEEKARG
ITINSAHVEYSSDKRHYAHVDCPGHADYIKNMITGAAQMDGAILVVSATDSVMPQTREHI
LLARQVGVPRMVVFLNKCDIATDEEVQELVAEEVRDLLTSYGFDGKNTPIIYGSALKALE
GDPKWEAKIHDLMNAVDEWIPTPEREVDKPFLLAIEDTMTITGRGTVVTGRVERGELKVG
QEIEIVGLRPIRKAVVTGIEMFKKELDSAMAGDNAGVLLRGVDRKEVERGQVLAKPGSIK
PHKKFKAEIYALKKEEGGRHTGFLNGYRPQFYFRTTDVTGSISLPENTEMVLPGDNTSIT
VELIAPIACEKGSKFSIREGGRTVGAGSVTEVLE
Download sequence
Identical sequences A0A0H3DNY0 P23568
gi|479053387|ref|YP_007348219.1| gi|385327218|ref|YP_005881650.1| gi|377822990|ref|YP_005175916.1| 272634.MPN665 NP_110354.1.17040 WP_010875022.1.101063 WP_010875022.1.11751 WP_010875022.1.12221 WP_010875022.1.12774 WP_010875022.1.13034 WP_010875022.1.14858 WP_010875022.1.1571 WP_010875022.1.16039 WP_010875022.1.16859 WP_010875022.1.19095 WP_010875022.1.22385 WP_010875022.1.22813 WP_010875022.1.23001 WP_010875022.1.24809 WP_010875022.1.24962 WP_010875022.1.2663 WP_010875022.1.27161 WP_010875022.1.28556 WP_010875022.1.28653 WP_010875022.1.28828 WP_010875022.1.29645 WP_010875022.1.31771 WP_010875022.1.32896 WP_010875022.1.34815 WP_010875022.1.35096 WP_010875022.1.35256 WP_010875022.1.35481 WP_010875022.1.35930 WP_010875022.1.3603 WP_010875022.1.4101 WP_010875022.1.43551 WP_010875022.1.44097 WP_010875022.1.45375 WP_010875022.1.46046 WP_010875022.1.50950 WP_010875022.1.54913 WP_010875022.1.56467 WP_010875022.1.56644 WP_010875022.1.60490 WP_010875022.1.61971 WP_010875022.1.63454 WP_010875022.1.63952 WP_010875022.1.66642 WP_010875022.1.66736 WP_010875022.1.68209 WP_010875022.1.6837 WP_010875022.1.69700 WP_010875022.1.71692 WP_010875022.1.73054 WP_010875022.1.73147 WP_010875022.1.73307 WP_010875022.1.77677 WP_010875022.1.781 WP_010875022.1.80830 WP_010875022.1.82550 WP_010875022.1.82952 WP_010875022.1.84725 WP_010875022.1.86690 WP_010875022.1.86924 WP_010875022.1.8980 WP_010875022.1.89898 WP_010875022.1.91711 WP_010875022.1.92395 WP_010875022.1.92743 WP_010875022.1.9360 WP_010875022.1.93817 WP_010875022.1.94569 WP_010875022.1.94657 WP_010875022.1.95064 WP_010875022.1.95674 WP_010875022.1.97031 WP_010875022.1.97508 WP_010875022.1.98952 WP_010875022.1.99226 gi|13508404|ref|NP_110354.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]