SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|377822333|ref|YP_005175259.1| from Mycoplasma pneumoniae 309

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|377822333|ref|YP_005175259.1|
Domain Number 1 Region: 53-156
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000412
Family N-acetyl transferase, NAT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|377822333|ref|YP_005175259.1|
Sequence length 274
Comment hypothetical protein MPNA0270 [Mycoplasma pneumoniae 309]
Sequence
MDKNTILEFCFFGDRYQLMALKNPNKLVKNKQVKAAFNVFMKHRTTLSATNYMAQIVENF
EQFLEYIHDKLQPGKLLALLFKNKQFLGWFCVGQWGNMPVLSFWIDPSQQQSGVALETIS
FFLKYYQRTLQPRELVWSFYESNQRSRHLANKLGFPSLFYFKKAEPNAPKVYFGTKDFKG
ESVIETKPYLGWGSGWKVNQMLKPTKNLTVNLINIGFDAYSDSQKALLAWFKTHKLTKGQ
VEVFFNYELCCLCISYNHKQSWVVYSFQQLLAKR
Download sequence
Identical sequences A0A0H3DL61
gi|385326640|ref|YP_005881072.1| gi|377822333|ref|YP_005175259.1| WP_014325294.1.11751 WP_014325294.1.12221 WP_014325294.1.14858 WP_014325294.1.16039 WP_014325294.1.16859 WP_014325294.1.22813 WP_014325294.1.2663 WP_014325294.1.27161 WP_014325294.1.28556 WP_014325294.1.28653 WP_014325294.1.28828 WP_014325294.1.35481 WP_014325294.1.3603 WP_014325294.1.43551 WP_014325294.1.44097 WP_014325294.1.54913 WP_014325294.1.66736 WP_014325294.1.6837 WP_014325294.1.71692 WP_014325294.1.781 WP_014325294.1.84725 WP_014325294.1.86924 WP_014325294.1.89898 WP_014325294.1.92395 WP_014325294.1.92743 WP_014325294.1.9360 WP_014325294.1.93817 WP_014325294.1.95674 WP_014325294.1.97508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]