SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27376083|ref|NP_767612.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27376083|ref|NP_767612.1|
Domain Number 1 Region: 15-164,213-383
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 1.44e-78
Family Acetamidase/Formamidase-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27376083|ref|NP_767612.1|
Sequence length 409
Comment amidase [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MPETLIKVDLTKSAYENDMVHNRWHPDIPIVAWVNPGDDFIIETYDWTGGFIKNNDSADD
VRDIDLSIVHFLSGPIGVKGAEPGDLLVVDLLDVGPLKESLWGFNGFFSKQNGGGFLTDH
FPLAQKSIWDIKGLYTSSRHVPGVNFAGLIHPGLIGCLPDPKMLDTWNKREAELISTNPT
RVPGLANPPFAPTAHGGRAKGDVKAKIGAEGARTVPPREHGGNCDIKDLSRGSKIYFPVY
VPGAGLSMGDLHFSQGDGEITFCGAIEMAGWLHLKVEVIKDGMAKYGIKNPIFKPSPITP
NYKDYLIFEGISVDEAGKQHYLDVHIAYRQACLNAIEYLKKFGYSGAQAYSILGTAPCQG
HISGVVDVPNACATLWLPTEIFDFDVMPSAAGPIKHITGDIQMPISPDK
Download sequence
Identical sequences A0A109QCZ2 A0A2A6N601 Q89VS3
NP_767612.1.11505 WP_008540630.1.15658 WP_008540630.1.86776 WP_008540630.1.90507 gi|27376083|ref|NP_767612.1| 224911.blr0972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]