SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27376702|ref|NP_768231.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27376702|ref|NP_768231.1|
Domain Number 1 Region: 20-123
Classification Level Classification E-value
Superfamily MtlR-like 4.97e-18
Family MtlR-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27376702|ref|NP_768231.1|
Sequence length 199
Comment hypothetical protein bll1591 [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MSNAYQELINSDPEWKRNYELIRTLGVESERGMAVLVGAELDRALELVLCAYLAPGKART
ELFAGSSPPLGTFSGKINLCRALHLINEDECTALHTIRKIRNEFAHDPDASFANAQIRSW
VDILRSNPEQDHKTRFELEAAGLIASLETTAVDQAHGRVYEESFNTWYRRGADRDAKPLK
SKEEAAEAYRSKRSDKTAR
Download sequence
Identical sequences A0A0A3XUW4 G7DI90 Q89U28
NP_768231.1.11505 WP_011084407.1.15658 WP_011084407.1.18950 WP_011084407.1.24896 WP_011084407.1.2739 WP_011084407.1.35620 WP_011084407.1.53516 WP_011084407.1.53518 WP_011084407.1.56529 WP_011084407.1.67972 WP_011084407.1.67973 WP_011084407.1.77977 WP_011084407.1.90507 WP_011084407.1.97209 gi|27376702|ref|NP_768231.1| gi|384221924|ref|YP_005613090.1| 224911.bll1591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]