SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27379576|ref|NP_771105.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27379576|ref|NP_771105.1|
Domain Number 1 Region: 6-48,87-147,194-410
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 4.05e-79
Family Acetamidase/Formamidase-like 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27379576|ref|NP_771105.1|
Sequence length 413
Comment hypothetical protein blr4465 [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MTHFTLPVSPKTVHWGYFSKTVAPALTLRSGDRATIETLTHHANDDYERMIQGDPGAESV
FQWTREHKAVARRGSGPVEGPFIRGAGEGIGVHLLTGPVAIEGAEPGDILEVRILDIRPR
PSCSACHAGRCFGSNVAANWGFHYHDLIEEPKPREVVTIFELDTSGEPYAKAVYNYVWTP
QTDPDGIVHPTIDYPGVRVDHATIKKRENILASMKVPARLHFGTMGLAPSEADFVSSIPP
SYTGGNIDDWRIGKGARMFYPVAVPGAYFSVGDPHAAQGDSELGGTAIETSLTGDFEFIL
HKKADLAGTNLEGLDHPMLETEQAWSFYGFTYPNYLAALGADAQTEIANHSSLDRAMRDA
FRKLRRFLMTVHGLSEDEAISLLSVGADFGVTQVVDANWGVHGTIRKNIFRCD
Download sequence
Identical sequences A0A2A6MWB8 Q89LS8
224911.blr4465 NP_771105.1.11505 WP_011087237.1.15658 WP_011087237.1.90507 gi|27379576|ref|NP_771105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]