SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27380092|ref|NP_771621.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27380092|ref|NP_771621.1|
Domain Number 1 Region: 6-310
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 5.62e-93
Family Acetamidase/Formamidase-like 0.0000295
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27380092|ref|NP_771621.1|
Sequence length 313
Comment amidase [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MTHHHLHSSPETCHWGFFEAALEPVLTVKSGDEVTVDTISGSPDVLPDRDKFHIPPEMHE
VHAKSERMLPGHILTGPIAVEGAEPGDVLAVEILDVQLRQDWGWNLIRPLSGTLPDDFHE
TRILNIPLDRTRMVGRMPWGLDLPLKPFFGVMGVSPPPAWGRISSLVPRAMGGNLDNKEL
GAGATLYLPVFVPGALFSCGDGHGVQGDGEVCVTAIETALQGRFRLTLRKDLRLDYPRAE
TPTHYMTMAMDPDLDQCVVRALRDMIALLGETRNLSREDAYTLCSLAADLRVTQTVNGSK
GIHCMIEKAIVHG
Download sequence
Identical sequences A0A2A6MYL8 Q89KC6
gi|27380092|ref|NP_771621.1| 224911.blr4981 NP_771621.1.11505 WP_011087744.1.15658 WP_011087744.1.90507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]