SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27375307|ref|NP_766836.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27375307|ref|NP_766836.1|
Domain Number 1 Region: 43-393
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.76e-81
Family L-arabinose binding protein-like 0.0000806
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27375307|ref|NP_766836.1|
Sequence length 405
Comment ABC transporter substrate-binding protein [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MFDRTQLSRRRFLSNFAFASGAVATGVGSWVIPAPWANAAEAPIKVGIATDLTGPIAYAG
NADANVAKMVIKEINAAGGMLGRPLELYIEDTASNESVAVGNVRKLIQRDKVDMVLGGIT
SSMRNAIKDPIVARGKTLYIYPQLYEGKECTPYLFCTGPTPAQQCDEFIPWLIKNGGKKF
ALPSANYVWPHTLNVYARKVIESNGGEVVFEEYYPLDQVDFSSTVNRIISNKVDVVFNTV
IPPGVGPFFKQLYEAGFLKNGGRLACVYYDENTLNINQASEIEGLASCLDYFKVLTKENP
FDAKIQAAYEKDFPGNFLFAAGSAATGTYRGLKLWEAAVKEAGKLDRESVAAALDHAKIA
EGPGGPAEMVPGKRHCKMKMYTAVAKGGNYEIVGRSDGLVDPKEC
Download sequence
Identical sequences A0A0M9BCZ3 A0A2A6N0S7 Q89XV9
224911.bll0196 NP_766836.1.11505 WP_011083028.1.15658 WP_011083028.1.2739 WP_011083028.1.53516 WP_011083028.1.53518 WP_011083028.1.67972 WP_011083028.1.90507 gi|27375307|ref|NP_766836.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]