SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27375998|ref|NP_767527.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27375998|ref|NP_767527.1|
Domain Number 1 Region: 45-407
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.8e-70
Family L-arabinose binding protein-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27375998|ref|NP_767527.1|
Sequence length 414
Comment ABC transporter substrate-binding protein [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MFVTLCNSLLPRNFESGGTIVRRSLIITTTILALAAGTSARADDLKVALIYGKTGPLEAY
AKQTETGLQMGFEYATKGTMTLDGRKIVVITKDDQGKPDLSKAALAEAYQDDKADIAIGT
TSSAAALAILPVAEENKKILIVEPAVADQITGEKWNRYIFRTARNSSQDAISNAVAIGKQ
GVTVATLAQDYAFGRDGVATFKEALAKTGATLAAEEYAPTSTTDFTAVGQRLFDALKDKP
GRKVIWVIWAGAGNPLAKLQDMDPKRYGIELSTGGNILPALAAYKGLPGMEGATYYFYEI
PKNPVNDWLVAEHQKRFNAPPDFFTAGGFAAAMSVVAAVTKAKSTDTEKLITAMEGLEFD
TPKGKMVFRKDDHQALQSMYHFKVKVDPNVAWAVLEPVRELKIEDMDVPVRNKR
Download sequence
Identical sequences A0A2A6N5Y7 Q89W06
224911.bll0887 NP_767527.1.11505 WP_011083709.1.15658 WP_011083709.1.90507 gi|27375998|ref|NP_767527.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]