SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27376023|ref|NP_767552.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27376023|ref|NP_767552.1|
Domain Number 1 Region: 59-420
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.53e-76
Family L-arabinose binding protein-like 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27376023|ref|NP_767552.1|
Sequence length 430
Comment hypothetical protein bll0912 [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MAPGAQQCVRQIIGNNKLRKLRMRNGMLHLATATALTLALSVSAANAQKKYDPGASDTEI
KVGQTVPFSGPASAYASIGKTQAAYFKMINDQGGINGRKINLIQYDDAYSPPKAVEQVRK
LVESDEVLLTFQIIGTPSNAAVQKYLNSKKVPQLFAATGASKFTDPKNFPWTMGYNPNYF
VEGRIYGQYILKEHPNAKIGVLYQNDDLGKDYLNGIKAGLGDKAAKMIVTEASYEVSDPT
VDSQILKIKDAGADLFFSATTPKQAAQAIKKIAELGWHPVQIVDINATSVGAVMKPAGLD
AAKGVISVNYGKDPLDPTWKDDAGMKRYLDFMAKYYPDGDKDSNFNTYGYGTAQLLAHVL
QQCGDNLTRENVMKQAASLKDVTGDIALPGIKANTSPTDYRVNKQLQMMKFNGERWELFG
PILEDAGPAG
Download sequence
Identical sequences A0A2A6N658 Q89VY3
NP_767552.1.11505 WP_011083734.1.15658 WP_011083734.1.2739 WP_011083734.1.53516 WP_011083734.1.53518 WP_011083734.1.67972 WP_011083734.1.90507 224911.bll0912 gi|27376023|ref|NP_767552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]