SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27376078|ref|NP_767607.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27376078|ref|NP_767607.1|
Domain Number 1 Region: 87-446
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.12e-90
Family L-arabinose binding protein-like 0.00000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27376078|ref|NP_767607.1|
Sequence length 451
Comment ABC transporter substrate-binding protein [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MQYTRSCVCLRCTNSSHPHGTNRVSSNKSGVLMSDEANKGLLSPLRRKLLMGMAAVPAIT
MLPRASFAQAPATSAVNTTGLAVTDTEVTVGILHSATGTMAISETGSIEAEKLAIEQINA
MGGVLGRKIKFIQEDGASDWPTFAEKAKKLLVNDKVAAIMGCWTSASRKAVLPVVEQYNG
MLYYPTFYEGLEQSKNVIYTGQEATQQILAGLNWIAKEKGAKSFFFIGSDYIWPRTSNKI
ARKHVENVLKGKVVGEEYYPLGNTQFNSVINKIKLTKPDVIFTDVVGGSNVAFYKQLKAA
GIDLAKQPLLTISVTEDEIDGIGGENIAGAYACMKYFQSLDNPNNKTFVPAFKKMWGEKT
VIGDVTQAAYLGPWLWKLTVEKAGSFDVDKIAAASPGVEFKGAPEGYVRIHENHHLWSKT
RVGRAKLDGQFELIYETADLVEPDPFPKGYQ
Download sequence
Identical sequences Q89VS8
224911.blr0967 NP_767607.1.11505 gi|27376078|ref|NP_767607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]