SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27378033|ref|NP_769562.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27378033|ref|NP_769562.1|
Domain Number 1 Region: 59-442
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.07e-70
Family L-arabinose binding protein-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27378033|ref|NP_769562.1|
Sequence length 444
Comment amino acid ABC transporter substrate-binding protein [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MGSVCCFFGLYRIHQSLHSISRNSVTEDFAMTISRRDVLLGATATAALVPLAARAQTSEV
VIGVIYPFSGGSAQQGVDAQKAYETALEVINKDTDFDLPLAKGEGLPGLGGAKVRLVFAD
HQADPQKGRAEAERLITQEKVSAIIGTYQSAVAVTVSQICERYQIPFVSADNSSPSLHRR
GLKYYFRAAPHDEMYSAAMFDFFDAMKKKGTKIETLSLFHEDTIFGTDSGNAQAKIAGER
AYKIVTDIKYRANSPSLSAEVQQLKTANADVLMPSSYTTDGILLVKTMAELGYKPNAIVA
QDAGFSEKALYDAVGDKLEGVISRGTFSLDLAQKRPMVGKINEMFKARSGKDFNDLTSRQ
FMGLIILADAISRAKSTDGEKVRDALAATDIPGEQTIMPWKRVKFDEMGQNNDADPVLLQ
YVGGKFVTIFPPQAAIAEAIWPMK
Download sequence
Identical sequences A0A0E4BTX6 Q89R50
NP_769562.1.11505 WP_011085706.1.15658 WP_011085706.1.69380 WP_011085706.1.90507 gi|27378033|ref|NP_769562.1| 224911.blr2922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]