SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27378361|ref|NP_769890.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27378361|ref|NP_769890.1|
Domain Number 1 Region: 92-285
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0000132
Family L-arabinose binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27378361|ref|NP_769890.1|
Sequence length 362
Comment hypothetical protein bll3250 [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MPAVRAKHPPWGNHHAKNFMTERPSAFAVDRRGFIRLAGTSAAGWLALGATSDRMRIVAS
LTGLPLDDELTRRSMTDSPTSRLGGLIVGLRQRGWVEGVNFRLELRSTFGSSDRLKTAVQ
ELLELKPDVILTGSTIETAAVLAATKTIPIVFATANDPVGNGFVESLAHPGGNVTGFTNS
SAEMGGKWLQLIREAVPDVARVGVLFNPATTPRGGRFFLDSIEQEAAASGVSVVPAPVNA
PTEIDEVIGRLSEPPKAAMVALVDSFLVIHRQAVVAAAAKYRVPTIYPFHYFMDAGGLMS
YGPTLEVRSADYVDLILRGTKAGDLPVQSPRKYELLINRTVARTLDLTIPFTLLARADEI
RE
Download sequence
Identical sequences A0A2A6N8H1 Q89Q80
224911.bll3250 NP_769890.1.11505 WP_011086034.1.15658 WP_011086034.1.90507 gi|27378361|ref|NP_769890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]