SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27378464|ref|NP_769993.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27378464|ref|NP_769993.1|
Domain Number 1 Region: 44-398
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.06e-83
Family L-arabinose binding protein-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27378464|ref|NP_769993.1|
Sequence length 402
Comment ABC transporter substrate-binding protein [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MTKAGLPRDQQRWIWRDNMTRALGLVRTIALATALFGGAAGAQTIKIGVNEPLTGAFAAS
GTYVVNGAKIAADEINAKGGILGKKIELVIEDNKSNPTEAAAVAEKLITSDKVPVLMGAW
GSSLTLAVMPKLMEYETPMVVETSSSGKITTTGNPFIFRISPPSAVEAAAFKGIVDKLAL
KKVDFLVINNDWGRGTAEDFSKMMKDKGISIGLVETMDQGAQDMSAQLSKIKSSDSETVI
VTTAVDQLTLIFKQAAALGLKKRIITTGGSQNPDQIIAQAGAAANGTMHLTTFLPWFPDK
TPNPEATNYFITEWKKRGFEFAGCTESFRGYDGIRTAAAAIEKAGKAEPAAIKAALWNIN
IKGLNGDIVFRKSGPEGKESGQSQPNVYLIEINDGKVGMKTL
Download sequence
Identical sequences A0A2A6N897 Q89PX7
NP_769993.1.11505 WP_011086137.1.15658 WP_011086137.1.90507 224911.blr3353 gi|27378464|ref|NP_769993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]