SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27380310|ref|NP_771839.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27380310|ref|NP_771839.1|
Domain Number 1 Region: 94-312
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000542
Family L-arabinose binding protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|27380310|ref|NP_771839.1|
Sequence length 373
Comment hypothetical protein bll5199 [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MSAGGKPDAGPTWRPPLLLSPGGYSISSVSETGRSEAAIVQRERELQRGRMRRRQFITLL
GGAVTWPLASSAQQPTRMPRVIRLAPVHIPVQVEGTRNALRELGYVEGRNIRLEFLNAAG
NVDALPAVAQEMVRDGGVDAIIAISTPAALAAYKATQTIPIVALTAVDPVGSGLADSLAH
PGRNVTGVTMFSEETTVKRVELMREVFPRAVRLGTVTTRLTSGAQSLSPVLETGRALGFR
VEHVDIDEPVDIAKALSPKILAGFDVLVFVPDVVLDAHMADIIKMIGLSKTPAIFASPDW
VTNGGLMSFGPDFSNANHHLILQLDRVLKGAKASDLPFERPTKFDLRINLRTAKTLGIEL
PPAVVARADTVIE
Download sequence
Identical sequences A0A2A6MUY6 Q89JS3
gi|27380310|ref|NP_771839.1| NP_771839.1.11505 WP_011087955.1.15658 WP_011087955.1.90507 224911.bll5199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]