SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27381518|ref|NP_773047.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27381518|ref|NP_773047.1|
Domain Number 1 Region: 132-490
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.41e-42
Family L-arabinose binding protein-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|27381518|ref|NP_773047.1|
Sequence length 520
Comment ABC transporter substrate-binding protein [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MPLRRSIADRIIRQCEVYCSISGAIKHEICQFPGLARIVFPWRGDLVQPFQTSFCSVRTK
LPSAELTNVGPSIRSASLHRRAFVVSKINPSLVPETGIADPARRDFLKAAAALTAGATLG
STGRAWAAADKKIRIGYISPKTGPFAPFAEADDFILDQVRKSLAGGLSVGGSKYEVEIIA
RDDQSSPDRQSNLAAELINKENIDLMLAQVSIGPAVSQQCELNGVPCISTMGPWQAWMFP
MKGDPAKGFKNVFHFFWGIEDIAAVYLDIWKDADTNKVVGSVFSNDVPGNAMGDAKLGMP
GAFAKAGYKIVDVGRFPVGADDFSTHIQAFKKEGVEIVTGLFNPPEWATFLNQSAQMGFK
PKVCTVAKALLFPGGVAALGPRAEGMSTEIWWLPSYPFRSSLTGQTAAELAASYQQATKR
EWTQPIGVAHALFEAGVQALKASGDPKSPNKVVESLRKLKTDTVIGNLDFGGSGIANVSK
IRVVGGQWHVEDGGKPHLYITSNSTAPEIKAERKLELLKS
Download sequence
Identical sequences Q89GD8
NP_773047.1.11505 WP_011089147.1.15658 224911.bll6407 gi|27381518|ref|NP_773047.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]