SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|27383038|ref|NP_774567.1| from Bradyrhizobium japonicum USDA 110

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|27383038|ref|NP_774567.1|
Domain Number 1 Region: 52-408
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.66e-76
Family L-arabinose binding protein-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|27383038|ref|NP_774567.1|
Sequence length 414
Comment hypothetical protein bll7927 [Bradyrhizobium diazoefficiens USDA 110]
Sequence
MANPSRNKGQGEETSMSKSFRAFGLAVSAVVLTHLPAAAQTKVTNEGISATEIVIGTHQD
LSGPIKGWGVPVSNGMKMAVEEVNAAGGVNGRKIRLVVEDSGYDPKKAVLASQKLIERDK
IFAMVGPMGSPTVLAAQDILLDAGVLQLFPLTAAEFTFKFDPAKPQERLKFNNLLPYVES
TRAALKYMMEWKSFQKPCIMHQDDEYGKNVLDGFNQQLAVMKVQPASITSYKRGASDFSA
QVAKMKSDGCDLVVLGAVLREPIGAMTEARKLGWDVTFLGATPVNVMEVPMLGKEAVEGL
YAASGFEIPYEDTAKGKVHDWLVNYKKMFNTDANTQAIIGYNAVMTFAFYAQKAGKDLTG
QKMLDSLESGEKFLDIFNSPPTKFSKTDHLANTITQVQQVKGGRWVLVKDNLMF
Download sequence
Identical sequences A0A2A6MVV7 Q89C70
224911.bll7927 gi|27383038|ref|NP_774567.1| NP_774567.1.11505 WP_011090651.1.15658 WP_011090651.1.90507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]