SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78059919|ref|YP_366494.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78059919|ref|YP_366494.1|
Domain Number 1 Region: 5-459
Classification Level Classification E-value
Superfamily Cytochrome P450 1.09e-107
Family Cytochrome P450 0.00000000256
Further Details:      
 
Domain Number 2 Region: 670-900
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.04e-57
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.00096
Further Details:      
 
Domain Number 3 Region: 496-641
Classification Level Classification E-value
Superfamily Flavoproteins 1.72e-36
Family Flavodoxin-related 0.0024
Further Details:      
 
Domain Number 4 Region: 903-1062
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.8e-36
Family NADPH-cytochrome p450 reductase-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78059919|ref|YP_366494.1|
Sequence length 1063
Comment cytochrome P450 [Burkholderia lata]
Sequence
MKSSSLVPQPPLKPVIGHLMEVLGPSPLAKMMDLARTYGPVYWFEVFGQGYYVVSGQTLV
DEVCDETRFQKCVHQSLLELRPAIGDGLFTAFGDEPNWAKAHRVLMQAFGPLSIWSMFDK
MVDIADQMFLHWERFGPETPVDVSDHMTRLTLDTIALCAFDCRFNSFYREDQHPFVDAMV
NTLSEAGKRELRPKLVSKLMVKRSRQFDADIEVMRSLATKMIEDRRKNPHVNEESMDLLD
RMLNGIDPVTGEKLDDENIVFQMITFLIAGHETTSGLLSFATYFLLKNPDILQKARDMVD
EVVGSETPRIEHLARLRYVEQILMETLRIWPTAPGFAVKPLADTTFGGKYAVSPDDIIMI
LTPMLHRDVSVWGEDVEAFRPERFAPENAEQLPPNSWKPFGNGARACIGRPFAMQEAHLV
LIMLLQRFDFSFADPDYELDVAETLTLKPAGFRVNVKPRARGALKVPDTALHARSNAQSP
SVAPVQSIAPGEDLSNLLVLFGGNTGSAESFARRIAGDASRHGFHATCAPLDDFAGKLGG
YPAIVIVTASYEGQPPDNAKSFVPYVEALDEGALDGVHFSVLGCGNKQWARTYQAIPKRV
DEALEKAGATRVHFRGELDSGGDFFGEFDRWYTEMWNRFAISAGKEIPVIQHDDVALKVS
FAGSSREKVLNLGDMAHASIVDNRELVDISVAGSRSKKHIELKLPEAMTYRSGDYLAVLP
RNAKNNVDRVLRRFRVSWDTQVVIEGTSSNPRLPLGQAIGCGELFSSYVELAVPATRSQV
SSLAAATRCPPEKVELERLSADGFECEILGKRTTVMDLLERFGSVDLSLEKFLDMLPALK
ARQYSISSSPLWKADHVTLTVAVVDAPALSGNGRHEGVASSYLARLNTGDSLSVAVRPSN
ARFRPPAEPDLPMILICAGSGIAPFRGFLQERALQKQRGENVGTSLLFFGIDDPDVDFLY
RDELDEWARCGVVEVMPAYSNRPEEGARFVQDKVWLERERISALFSQGATVFVCGDGKNM
APAVRATLGRIYQETTGENDESASAWIDTMEREHGRYVADVFA
Download sequence
Identical sequences Q39NW6
WP_011349494.1.41686 gi|78059919|ref|YP_366494.1| 269483.Bcep18194_C6803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]