SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78059988|ref|YP_366563.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78059988|ref|YP_366563.1|
Domain Number 1 Region: 13-220,316-455
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.53e-65
Family FAD-linked reductases, N-terminal domain 0.0000000926
Further Details:      
 
Domain Number 2 Region: 221-315
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.04e-38
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.0000133
Further Details:      
 
Domain Number 3 Region: 457-557
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.62e-28
Family ETF-QO domain-like 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78059988|ref|YP_366563.1|
Sequence length 557
Comment electron-transferring-flavoprotein dehydrogenase [Burkholderia lata]
Sequence
MTTQDLLAQYGPRESMEYDVVIVGGGPAGLSAAIRLKQLAAEKGTEIGVCVLEKGSEIGA
HILSGAVMDPRAINELFPDWKERGAPLDVEVTEDRFLFLSEKGAVTTPNWALPANFQNHG
NYVISLGNVTRWLGAQAEALGVEIFPGFPAAEILYNDDGSVKGVATGNMGVGKDGEPTEN
FQLGMELHAKYTLFAEGCRGHLGRQLISKFKLDANADPQAYGIGIKELWEIDPAKHKPGL
VIHTAGWPLKSDTYGGSFLYHMDNNQVVVGFVVGLGYTNPYLSPFEEFQRYKTHPSIRAF
LEGGKRVSYGARAITAGGLLSLPKTVFPGGALIGDDAGFLNASRIKGSHAAIKTGMLAAD
AAFDAVQAGRQSDELNVYPDAFKQSWLYTELYRARNFKQWMAKGLYLGTLMVGLEQKVMG
GNVPWTLHHKHADHEMLKPASQCEPIEYPKPDGKLTFDRLSSVFISNTNHEENQPAHLTL
KDANVPVNVNLRTYAGPEGRFCPAAVYEFVKNDDGSDRLVINAQNCVHCKTCDIKDPTQN
IVWVTPEGGGGPNYPNM
Download sequence
Identical sequences Q39NP7
WP_011349563.1.41686 269483.Bcep18194_C6873 gi|78059988|ref|YP_366563.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]