SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78059993|ref|YP_366568.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78059993|ref|YP_366568.1|
Domain Number 1 Region: 7-554
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.83e-137
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00011
Further Details:      
 
Domain Number 2 Region: 919-1053
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 4.19e-32
Family Aromatic dioxygenase reductase-like 0.067
Further Details:      
 
Domain Number 3 Region: 658-802
Classification Level Classification E-value
Superfamily ADC-like 3.84e-28
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0097
Further Details:      
 
Domain Number 4 Region: 801-916
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.72e-21
Family Ferredoxin reductase FAD-binding domain-like 0.0011
Further Details:      
 
Domain Number 5 Region: 1044-1147
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.19e-20
Family 2Fe-2S ferredoxin-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78059993|ref|YP_366568.1|
Sequence length 1148
Comment molybdopterin oxidoreductase [Burkholderia lata]
Sequence
MDIQEKKGYCTLCRSRCGTINVVRGDMMIKVWPDETHPTGHAMCMKGKAAPELVHSPNRV
LYPMRRTRPKGAADPGWKRIGWEEALSEIAERLAYFKRENGAESVAFGVTTPSGTPMSDS
IDWVERFVWLFGSPNICYATEICNWHKDSAHVFTFGCGMPTADYQQADLIVLWGNNPANT
WLAQADAIAKGRRRGAKLIVVDPRPTPLAREADLWLRVNPGTDGALAMAIARQMIAIGNV
DEPFVRRWTNGPLLVRADTGRFLRERDIDPHASGNRYALWNQTLDRLELVEEEAGTALSD
LSMTGTRHVGITDSAGRCTQVECTPAFDLYARALAAYTPELASTITGIDAADIMKAAQML
HPGQGIAYHAWSGVGMHTNATQTERAIATLYALTGAFDTRGSNREWAKQPANAVSSYAML
NPGQRAKALGLAERPLGPPSQGWVTARDVYRAILDAEPYRVRALFAFGTNMVLSQADGGI
AHNALCALDFHVHCDLFETPSSRYADILLPVNTPWEREGLRLGFEINERAVELVQLRQRM
VPPRGESRADYDIVFDLAVRLGMKDRFFGGSIEAGWNHVLEPLGMDVALLRTHPEGIARP
LTQYERRYASATPDGVRGFNTETLRVELYSEKLHRHGYPAVPQYVPPQHGLGEGVNDRRR
FPYTLTSMKNGYYCHSQHRGLPSLRRRAPYPVAELNDALAAEHGIVDDDWFLVETTNGSA
RFKARIVPELAHDVIVAEYGWWQACDEIGMDALAVEGRNHSNFNRLVSAARLDPVSGSSP
LRSVRCRIRPDPSTDPSRRAWKGRRDFVVSAIHEEASGVRTVTFRASDRGALPDYLPGQH
VTVHVPALGDGGTTRAYSLTGAASEDDRRTYSISVRHQKGRTGEGVPFEGAMSSYIHGSL
KVGDPVLLGAPAGTFIVPPASKQPVVMFAGGIGITPFISYLESIRDRGAQAPESRLFYAN
QNSGTHAFRERIERLKQRLPKLEVVNCYNQPHDEVLGRDYQIRGYLTADVVSDDLIQRRA
RFYLCGPEPMMQAITAGLIERGVPPFDIFKEAFRSPSRPALDPSKRFVVQFTRSRRVSTW
TPRDGSLLSFAESLGVVMPSGCRVGQCESCAVKVVSGEVAHLSGHGPDEPDVCLACQAIP
ATDVAIDA
Download sequence
Identical sequences Q39NP2
WP_011349568.1.41686 gi|78059993|ref|YP_366568.1| 269483.Bcep18194_C6878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]