SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78061429|ref|YP_371337.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78061429|ref|YP_371337.1|
Domain Number 1 Region: 122-265
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 3.4e-36
Family Reductases 0.019
Further Details:      
 
Domain Number 2 Region: 35-132
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.28e-30
Family Ferredoxin reductase FAD-binding domain-like 0.0026
Further Details:      
 
Domain Number 3 Region: 261-381
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.1e-28
Family 2Fe-2S ferredoxin-related 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78061429|ref|YP_371337.1|
Sequence length 382
Comment ferredoxin/oxidoreductase [Burkholderia lata]
Sequence
MMRDAANFEPTDSRVTRPAFWNGLPERWTSDVEETLVCCHVRQETHDVKSFFFRSPQGRS
FSFEPGQFLTLELDIDGETINRCYTISSSPARPHTVSITVKRVPGGKVSNWLHDNLQPGA
PVRVLGPAGEFTCARHPARKYLFLSAGSGVTPLMSMSRAHHDLAEDRDILFVHSARTPDD
IIFARELDLIASNHTNFRTSFVVERVGARTNWPGVTGFLTLPLLKLIAPDFMEREIFTCG
PAPYMKAVRDLLDEAGFERKQYHEESFSFETLAQTASDELLADLAPPAEGADTDTKQYTV
SFAKSNREISCGSEQHVLDAARQSGVRLPASCTQGMCGTCKVKLVSGQVEMKHNGGIRQR
EIDQGMVLLCCSKPLSDLVIDK
Download sequence
Identical sequences Q39A18
gi|78061429|ref|YP_371337.1| WP_011354187.1.41686 269483.Bcep18194_B0579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]