SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78061970|ref|YP_371878.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|78061970|ref|YP_371878.1|
Domain Number - Region: 13-34
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0319
Family Short-chain ferredoxins 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78061970|ref|YP_371878.1|
Sequence length 75
Comment hypothetical protein Bcep18194_B1120 [Burkholderia lata]
Sequence
MAKKFPLHPVHPERICWGCDNYCPTHAMRCGNGSSRTQHPSELLGDDWYRYGDWGIEGAD
ADNESERATEAGGQS
Download sequence
Identical sequences Q397X7
269483.Bcep18194_B1120 gi|78061970|ref|YP_371878.1| WP_011354727.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]