SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|78062004|ref|YP_371912.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78062004|ref|YP_371912.1|
Domain Number 1 Region: 9-171
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.74e-27
Family N-acetyl transferase, NAT 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78062004|ref|YP_371912.1|
Sequence length 186
Comment GCN5-related N-acetyltransferase [Burkholderia lata]
Sequence
MPTAPACVVRDATDADLEAIHAIYAHHVHHSVASFEETPPDVAELRARRDAVLRQGLPYL
VAECDGRVAGYAYATPYRTRSAYRFTIEDSIYIDDAQRGRGIGRALLAALIERCEAGPWR
QMIAVIADGGTGGSTSLHRAFGFEPAGMLKAAGFKHGRWIDTALLQRPLGEGARTLPVSP
EPASSR
Download sequence
Identical sequences Q397U3
gi|78062004|ref|YP_371912.1| 269483.Bcep18194_B1154 WP_011354760.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]