SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78062196|ref|YP_372104.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78062196|ref|YP_372104.1|
Domain Number 1 Region: 5-618
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 4.06e-189
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000588
Further Details:      
 
Domain Number 2 Region: 1026-1242
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1.59e-59
Family NADPH-cytochrome p450 reductase FAD-binding domain-like 0.000088
Further Details:      
 
Domain Number 3 Region: 1240-1395
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 9.56e-50
Family NADPH-cytochrome p450 reductase-like 0.0000675
Further Details:      
 
Domain Number 4 Region: 572-717
Classification Level Classification E-value
Superfamily ADC-like 1.29e-47
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.00032
Further Details:      
 
Domain Number 5 Region: 859-1005
Classification Level Classification E-value
Superfamily Flavoproteins 9.52e-44
Family Cytochrome p450 reductase N-terminal domain-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78062196|ref|YP_372104.1|
Sequence length 1395
Comment sulfite reductase (NADPH) alpha subunit [Burkholderia lata]
Sequence
MTATPVKSVCPYCGVGCGMVLHVEEGEVVKVSGDSDHPTNFGRLCTKGSSAHVALRRSGR
LDRAFVRRAREDDLVPLSGRDAIAETARRLRTVLDTYGPDALSFYVSGQMSIEAQYLVNK
LAKGFVGTNNIESNSRLCMASAGTGYKQSLGADGPPGSYQDFDRANLFFVIGANMADCHP
ILFLRMMDRVKAGAKLIVVDPRRTGTADKADLFLQIRPGTDLALTNGLLHLLHANGRTDA
AFIDAYTEGWDAMPAFLADYTPERVAEITGLAEADLRTAAQWIGDAQEWMSCWTMGLNQS
THGVWNTNAICNLHLATGRICRPGSGPFSLTGQPNAMGGREMGYMGPGLPGQRSVASDDD
RRFVENLWRVPAGTLRKETGQGTVDMFSRMAAGDIKACWIICTNPVATVPNRQNVIAGLQ
AAELVIAQDAFLDTETNRYADILLPGALWAEGDGVMINSERNLTLMRAAVAPPGDALPDW
RIVAEVARAMGFGDAFDYASAADVFDEIVRFSNPATGYDLRGASHAALRDGPVQWPVAPG
TARERHPIRYLNDGVSQTLRPAADGNDAPRLAFPTPSGKARFFARPHVDPAELPDDTFPI
VLNTGRLQHQWHTMTKTGKVAMLNKLNPRPFVELHPDDASALGIAAKDSVEIRSARGRAV
LPAVVTERVQRGNCFAPMHWNDVYGDDLCINAVTNDAIDPESQQPELKYCAVALRRVETD
AFASADDETAQPDARADDVRPAPVMTQATASQESDMADIDTFAAALGVADLAPPPLTDTE
RLYVAGLVSGLKASAGKREGSVPVLPAAAPLTPPVRFWLDGMLAGLFSRSLPASVPGAAA
PALPADAGASGGVRIVRTRPKVVLLWASQTGNIESLTEDYATQLMNAGFEIRTACMSDYP
VASLAGAQYVLLMTSTFGDGDAPDNGSEFWEALQAGSAARLDGVHFAVLAFGDRNYDQFC
GHGRRLDARLAELGAARLCARVDCDVEFQRDADQWLERVVARIKEADAALHAVPTGGMSP
SGLLPTKAHPAPSKLVANLRLNRPGAAKDTRCVSLSTEGANLEYETGDALGVWPTNCPEL
VDELLSVTALKADSPVSVAGVGDVRLGDALARHFDITRPHPDTLAFIASRSANGALKSLL
GDERKGDLKQWLWGQQLADVLHEFPVELSGTELVGMLKRMQPRLYSIASSPSAHQGEIHL
TVSAVRYHNGRRARKGVASTFLADRADDGRVPVFVQKSAHFRPPVNGDVPIVMVGPGTGV
APFRGFLHERQARGARGRNWLFFGEQHAQTDFYYGDELGAMHDSGFLTRLDLAFSRDQAD
KIYVQDRMREQGAELFAWLEEGAHFYVCGDAARMAKDVDTALKAVVAEHGGMSDEAANDY
VARLSKARRYMRDVY
Download sequence
Identical sequences Q397A1
269483.Bcep18194_B1346 gi|78062196|ref|YP_372104.1| WP_011354950.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]