SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78062392|ref|YP_372300.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78062392|ref|YP_372300.1|
Domain Number 1 Region: 151-223
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 6.67e-22
Family CO dehydrogenase ISP C-domain like 0.001
Further Details:      
 
Domain Number 2 Region: 58-138
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 2.36e-16
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78062392|ref|YP_372300.1|
Sequence length 233
Comment (2Fe-2S)-binding protein [Burkholderia lata]
Sequence
MTTAQTAASAASASAAATGASAPSAASAAPASAPAPAVPASTPAAVERPLVRFQSKPLSI
NINGKSVGPMQVPEGLMMIEFLHEYVGLTGSRLGCGQGICHACVVIVDKPDGTSEEMRTC
ITGAHFFHGRSIRTIEGHAKRNEAGEVVELSPIQQKFLEHFSFQCGYCTPGFVNAATVLI
ERLKREPVAKADVERTITEALDAHLCRCTGYVRYYEAVKDVVLTTPGLVKDAA
Download sequence
Identical sequences Q396F5
WP_011355145.1.41686 269483.Bcep18194_B1542 gi|78062392|ref|YP_372300.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]