SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78062946|ref|YP_372854.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78062946|ref|YP_372854.1|
Domain Number 1 Region: 29-287
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 6.17e-72
Family Ferredoxin domains from multidomain proteins 0.000000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|78062946|ref|YP_372854.1|
Sequence length 304
Comment formate dehydrogenase beta subunit [Burkholderia lata]
Sequence
MALQSLDIKRVSATTTPPPTVREPVTGSVAKLIDVSKCIGCKACQTACMEWNDLRDEVGT
NVGVYDNPADLTEHSWTVMRFSEYENPAGDLEWLIRKDGCMHCEDPGCLKACPSPGAIVQ
YNNGIVDFHEENCIGCGYCVTGCPFNVPRISKKDHRAYKCTLCSDRVAVGQEPACVKTCP
TGAIVFGTKEDMKQHAAERIEDLKERGFEHAGLYDPQGVGGTHVMYVLHHADKPSLYHGL
PDNPSISPMVKLWKGIAKPLAVAGIALTALAGFFHYVRVGPNEVSDEEEQAARDEARRIK
EDAK
Download sequence
Identical sequences A0A228GK93 A0A228PD96 Q394A6
WP_011355694.1.36191 WP_011355694.1.41686 WP_011355694.1.99173 WP_011355694.1.99354 gi|78062946|ref|YP_372854.1| 269483.Bcep18194_B2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]