SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78063182|ref|YP_373090.1| from Burkholderia lata

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78063182|ref|YP_373090.1|
Domain Number 1 Region: 2-364
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.05e-108
Family FMN-linked oxidoreductases 0.000000002
Further Details:      
 
Domain Number 2 Region: 335-522
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 8.12e-40
Family N-terminal domain of adrenodoxin reductase-like 0.000014
Further Details:      
 
Domain Number 3 Region: 464-522,558-655
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.99e-26
Family C-terminal domain of adrenodoxin reductase-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|78063182|ref|YP_373090.1|
Sequence length 677
Comment 2,4-dienoyl-CoA reductase [Burkholderia lata]
Sequence
MTTTFPHLLAPLDLGFTTLKNRVLMGSMHTGLEDSRKTLPRLAEYFAERARGGVGLIVTG
GFAPNVAGWTKPFGGTLMTSAAARRHREITDAVHREDGKIALQILHTGRYGYHPFAVAPS
KIKSPISPFAPHELSAGGVERQIRAFVRCAKLAREAGYDGVEIMGSEGYLINQFISMHTN
KRTDQWGGSYENRIRLPIEIIERTREAVGRDFILIYRLSMLDLIPDGSDWSETVQLAKAV
ERAGATIINTGIGWHEARVPTIATSVPRGAFAWVTKKMKGEVGIPLVTTNRINRPEVAEQ
ILADGCADMVSMARPLLADAEFVVKAAQGRADEINTCIGCNQACLDHAFKNKIASCLLNP
RACHETELKYTPAAQPKRIAVVGAGPAGLACSTVLAQRGHQVDLFDGAAEIGGQFNMAKR
VPGKEEFHEALSYFGRQVELTGVNLHLNRRVDASDLIAGGYDEIVLATGVAPRDPKIPGQ
DGPNVLSYIDVLAGRQPVGRRVAVVGAGGIGFDVAEYLVQEGESPALDLDEWKAEWGVTD
PAATRGGVTRAQVTAPAREVTLLQRKAAPLGKGLGKTTGWIHRATLKMKQVKMIGGVNYE
LIDARGLHVSYGEQRTDHELIEADTIVLCTGQEPQRALLAPLQAAGRSVHLIGGAELAAE
LDAKRAIDQGSRLAARL
Download sequence
Identical sequences Q393C0
gi|78063182|ref|YP_373090.1| 269483.Bcep18194_B2335 WP_011355928.1.41686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]